PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038559.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 315aa    MW: 35739.6 Da    PI: 5.9397
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038559.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.6e-121154144
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +g+W +eEde l++ vk+ G+++W++I ++  + Rt+k+c++rw
      Pbr038559.1 11 KGPWKAEEDEVLLNHVKKCGPRDWSSIRSKGLLQRTGKSCRLRW 54
                     79*************************8887799********** PP

2Myb_DNA-binding42.41.7e-1367106344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++ eE+   +++ +q+G++ W++Ia +++ gRt++++k++w
      Pbr038559.1  67 KFSVEEERMVIELQAQFGNK-WARIATYLP-GRTDNDVKNFW 106
                      799*****************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.099658IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-19659IPR009057Homeodomain-like
SuperFamilySSF466891.21E-278106IPR009057Homeodomain-like
SMARTSM007176.1E-91060IPR001005SANT/Myb domain
CDDcd001675.15E-101354No hitNo description
PfamPF139211.1E-101464No hitNo description
PROSITE profilePS5129419.75459114IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-1760112IPR009057Homeodomain-like
SMARTSM007178.3E-1364112IPR001005SANT/Myb domain
PfamPF002494.6E-1267106IPR001005SANT/Myb domain
CDDcd001671.05E-1067106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MEGKKEEGIR KGPWKAEEDE VLLNHVKKCG PRDWSSIRSK GLLQRTGKSC RLRWVHKLRP  60
NLKNGCKFSV EEERMVIELQ AQFGNKWARI ATYLPGRTDN DVKNFWSSRQ KRLARILQTP  120
TAATFSKSHK TRREVSVFHE LPTLQAPKFN CSSEGEPSTQ ALSCSSPAPY IWNSEIIKMV  180
PLPDIVKPES ICFKTNPVQH ELTITDMDTR NEPQSVIPFL QNRQPQTDLF SSETQELLAT  240
FDPYFDMLVP LDASELGNGE PLPMEPPLFE PVGSCVSCER EQIDHTMAPD CLLDDFPTDM  300
FDQLDPLPNT SGQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-25911225126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009345055.10.0PREDICTED: transcription factor MYB48
TrEMBLM5VT831e-152M5VT83_PRUPE; Uncharacterized protein
STRINGVIT_15s0021g02040.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.17e-88MYB family protein